PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00008515-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family HSF
Protein Properties Length: 414aa    MW: 45838.3 Da    PI: 6.237
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00008515-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind66.94.4e-211373262
                      HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTE CS
      HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgF 62
                      Fl+k+y+++ed++++ ++sws ++nsf+v+++ ef++ ++p+yFkh+nf+ F+ QLn+Y  
  PSME_00008515-RA 13 FLTKTYDMVEDPTTNAMVSWSPSSNSFIVWNPAEFSDVLVPTYFKHNNFSNFLMQLNTYKG 73
                      9********************999*************999*******************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.104.7E-24676IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467852.04E-19872IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004159.4E-239111IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004473.8E-1913160IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000565.0E-131336IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000565.0E-135163IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000565.0E-136476IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MFRNGSSNGP PPFLTKTYDM VEDPTTNAMV SWSPSSNSFI VWNPAEFSDV LVPTYFKHNN  60
FSNFLMQLNT YKGESLSGGA CVEIKQLEDE TEKLRQEKQG LVIELVRLKL HQQGTEFDLQ  120
SLEERLQVME QRQHRMMAFL AKAVQNPNFL VQHHDKITHI ATTNKKRRLP NHDEVLEIGE  180
NGCTGSQIVR YDHGKSDAFN RDSPDKLETS MDAFKTFFDD LPADAHDKSK DSGSPPSHSL  240
GSSLTEMHGK PCFPDMPVHL GVSDIYTSSA LSDLNSSSRF PDMSISLRSR YMQASEGLVG  300
SLHSDILCNL SLSPHSSLHE VSKIDATGKA ILSGSPENRS VIESKTGSND ANLEAVDVEV  360
RLPYGAVKTT LEEGSINGKG RRTGPGGTGK GMGNEISKKR INDVFWEQFL TKSP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B5e-1611712787Heat shock factor protein 1
5d5v_B5e-1611712787Heat shock factor protein 1
5d5v_D5e-1611712787Heat shock factor protein 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1175890.0BT117589.1 Picea glauca clone GQ03904_J01 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0C9S8X01e-114A0A0C9S8X0_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_2945_1895 transcribed RNA sequence
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02990.17e-53heat shock transcription factor A1E